Lineage for d4f77p_ (4f77 P:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787534Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries)
  8. 2787574Domain d4f77p_: 4f77 P: [251915]
    Other proteins in same PDB: d4f77a_, d4f77b_, d4f77g_, d4f77i_, d4f77j_, d4f77o_, d4f77q_, d4f77r_, d4f77w_, d4f77y_, d4f77z_
    complexed with so4
    complexed with so4

Details for d4f77p_

PDB Entry: 4f77 (more details), 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate
PDB Compounds: (P:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d4f77p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f77p_ b.38.1.0 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirg
nsiimleale

SCOPe Domain Coordinates for d4f77p_:

Click to download the PDB-style file with coordinates for d4f77p_.
(The format of our PDB-style files is described here.)

Timeline for d4f77p_: