Lineage for d1sbbd1 (1sbb D:1-121)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59304Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 59316Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 59317Species Staphylococcus aureus [TaxId:1280] [50227] (10 PDB entries)
  8. 59324Domain d1sbbd1: 1sbb D:1-121 [25191]
    Other proteins in same PDB: d1sbba1, d1sbba2, d1sbbb2, d1sbbc1, d1sbbc2, d1sbbd2

Details for d1sbbd1

PDB Entry: 1sbb (more details), 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb

SCOP Domain Sequences for d1sbbd1:

Sequence, based on SEQRES records: (download)

>d1sbbd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

Sequence, based on observed residues (ATOM records): (download)

>d1sbbd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktshqtdkrktcmyggvteh

SCOP Domain Coordinates for d1sbbd1:

Click to download the PDB-style file with coordinates for d1sbbd1.
(The format of our PDB-style files is described here.)

Timeline for d1sbbd1: