Lineage for d4f77g_ (4f77 g:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057138Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 2057316Protein D1 core SNRNP protein [50184] (2 species)
  7. 2057317Species Human (Homo sapiens) [TaxId:9606] [50185] (5 PDB entries)
  8. 2057328Domain d4f77g_: 4f77 g: [251908]
    Other proteins in same PDB: d4f774_, d4f77b_, d4f77d_, d4f77f_, d4f77h_, d4f77j_, d4f77l_, d4f77n_, d4f77p_, d4f77r_, d4f77t_, d4f77v_, d4f77x_, d4f77z_
    complexed with so4
    complexed with so4

Details for d4f77g_

PDB Entry: 4f77 (more details), 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate
PDB Compounds: (g:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d4f77g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f77g_ b.38.1.1 (g:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllvdv

SCOPe Domain Coordinates for d4f77g_:

Click to download the PDB-style file with coordinates for d4f77g_.
(The format of our PDB-style files is described here.)

Timeline for d4f77g_: