Class a: All alpha proteins [46456] (285 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (5 species) not a true protein |
Species Horse (Equus caballus) [TaxId:9796] [256129] (5 PDB entries) |
Domain d4f5ta3: 4f5t A:388-583 [251893] automated match to d4emxa3 complexed with act, gol, so4 |
PDB Entry: 4f5t (more details), 2.32 Å
SCOPe Domain Sequences for d4f5ta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f5ta3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]} kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgredkeacf aeegpklvassqlala
Timeline for d4f5ta3: