Lineage for d1se3a1 (1se3 A:1-121)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667804Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 667823Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 667824Species Staphylococcus aureus [TaxId:1280] [50227] (12 PDB entries)
  8. 667834Domain d1se3a1: 1se3 A:1-121 [25189]
    Other proteins in same PDB: d1se3a2
    complexed with gal, glc, sia

Details for d1se3a1

PDB Entry: 1se3 (more details), 2.3 Å

PDB Description: staphylococcal enterotoxin b complexed with gm3 trisaccharide
PDB Compounds: (A:) staphylococcal enterotoxin b

SCOP Domain Sequences for d1se3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se3a1 b.40.2.2 (A:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

SCOP Domain Coordinates for d1se3a1:

Click to download the PDB-style file with coordinates for d1se3a1.
(The format of our PDB-style files is described here.)

Timeline for d1se3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se3a2