SCOPe 2.08: Domain d4f5sb1: 4f5s B:1-195

Lineage for d4f5sb1 (4f5s B:1-195)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [256128] (5 PDB entries)

8. Domain d4f5sb1: 4f5s B:1-195 [251888]
   automated match to d3jrya1
   complexed with pge

Details for d4f5sb1

PDB Entry: 4f5s, 2.47 Å

PDB Description: crystal structure of bovine serum albumin

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4f5sb1:

Sequence; same for both SEQRES and ATOM records:

>d4f5sb1 a.126.1.0 (B:1-195) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
ietmrekvltssarq

Timeline for d4f5sb1:

• d4f5sb1 first appeared in SCOPe 2.04
  
• d4f5sb1 appears in SCOPe 2.07