SCOPe 2.04: Domain d4f52b_: 4f52 B:

Lineage for d4f52b_ (4f52 B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
   Uniprot P62877 19-106

8. Domain d4f52b_: 4f52 B: [251880]
   automated match to d3dplr_
   complexed with zn

Details for d4f52b_

PDB Entry: 4f52, 3 Å

PDB Description: Structure of a Glomulin-RBX1-CUL1 complex

PDB Compounds: (B:) E3 ubiquitin-protein ligase RBX1

SCOPe Domain Sequences for d4f52b_:

Sequence, based on SEQRES records:

>d4f52b_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnhaf
hfhcisrwlktrqvcpldnrewefq

Sequence, based on observed residues (ATOM records):

>d4f52b_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatsectvawgvcnhafh
fhcisrwlktrqvcpldnrewefq

Timeline for d4f52b_:

• d4f52b_ is new in SCOPe 2.04-stable
  
• d4f52b_ appears in SCOPe 2.05
  
• d4f52b_ appears in the current release, SCOPe 2.08