Lineage for d4f52b_ (4f52 B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588606Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2588607Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2588608Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2588641Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species)
  7. 2588642Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries)
    Uniprot P62877 19-106
  8. 2588644Domain d4f52b_: 4f52 B: [251880]
    automated match to d3dplr_
    complexed with zn

Details for d4f52b_

PDB Entry: 4f52 (more details), 3 Å

PDB Description: Structure of a Glomulin-RBX1-CUL1 complex
PDB Compounds: (B:) E3 ubiquitin-protein ligase RBX1

SCOPe Domain Sequences for d4f52b_:

Sequence, based on SEQRES records: (download)

>d4f52b_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnhaf
hfhcisrwlktrqvcpldnrewefq

Sequence, based on observed residues (ATOM records): (download)

>d4f52b_ g.44.1.1 (B:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}
krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatsectvawgvcnhafh
fhcisrwlktrqvcpldnrewefq

SCOPe Domain Coordinates for d4f52b_:

Click to download the PDB-style file with coordinates for d4f52b_.
(The format of our PDB-style files is described here.)

Timeline for d4f52b_: