Lineage for d1d6ec1 (1d6e C:2-121)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13929Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 13940Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 13941Species Staphylococcus aureus [TaxId:1280] [50227] (10 PDB entries)
  8. 13946Domain d1d6ec1: 1d6e C:2-121 [25188]
    Other proteins in same PDB: d1d6ea1, d1d6ea2, d1d6eb1, d1d6eb2, d1d6ec2

Details for d1d6ec1

PDB Entry: 1d6e (more details), 2.45 Å

PDB Description: crystal structure of hla-dr4 complex with peptidomimetic and seb

SCOP Domain Sequences for d1d6ec1:

Sequence, based on SEQRES records: (download)

>d1d6ec1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d1d6ec1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskkrktcmyggvteh

SCOP Domain Coordinates for d1d6ec1:

Click to download the PDB-style file with coordinates for d1d6ec1.
(The format of our PDB-style files is described here.)

Timeline for d1d6ec1: