SCOPe 2.05: Domain d4f21h_: 4f21 H:

Lineage for d4f21h_ (4f21 H:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [256250] (1 PDB entry)

8. Domain d4f21h_: 4f21 H: [251874]
   automated match to d1auoa_
   complexed with 0s1

Details for d4f21h_

PDB Entry: 4f21, 2.5 Å

PDB Description: crystal structure of carboxylesterase/phospholipase family protein from francisella tularensis

PDB Compounds: (H:) Carboxylesterase/phospholipase family protein

SCOPe Domain Sequences for d4f21h_:

Sequence, based on SEQRES records:

>d4f21h_ c.69.1.0 (H:) automated matches {Francisella tularensis [TaxId: 177416]}
snamnyelmepakqarfcviwlhglgadghdfvdivnyfdvsldeirfifphadiipvti
nmgmqmrawydiksldanslnrvvdveginssiakvnklidsqvnqgiaseniilagfsq
ggiiatytaitsqrklggimalstylpawdnfkgkitsinkglpilvchgtddqvlpevl
ghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfiaktfki

Sequence, based on observed residues (ATOM records):

>d4f21h_ c.69.1.0 (H:) automated matches {Francisella tularensis [TaxId: 177416]}
snamnyelmepakqarfcviwlhghdfvdivnyfdvsldeirfifphaipvtimrawydi
kvvdveginssiakvnklidsqvnqgiaseniilagfsqggiiatytaitsqrklggima
lstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyv
gmqhsvcmeeikdisnfiaktfki

Timeline for d4f21h_:

• d4f21h_ first appeared in SCOPe 2.04
  
• d4f21h_ is called d4f21h1 in SCOPe 2.06
  
• d4f21h_ appears in the current release, SCOPe 2.08, called d4f21h1