Class b: All beta proteins [48724] (126 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins) |
Protein Staphylococcal enterotoxin B, SEB [50226] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50227] (13 PDB entries) |
Domain d1se4_1: 1se4 1-121 [25187] Other proteins in same PDB: d1se4_2 complexed with lat |
PDB Entry: 1se4 (more details), 1.9 Å
SCOP Domain Sequences for d1se4_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se4_1 b.40.2.2 (1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus} esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte h
Timeline for d1se4_1: