Lineage for d1se4_1 (1se4 1-121)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59304Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 59316Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 59317Species Staphylococcus aureus [TaxId:1280] [50227] (10 PDB entries)
  8. 59321Domain d1se4_1: 1se4 1-121 [25187]
    Other proteins in same PDB: d1se4_2

Details for d1se4_1

PDB Entry: 1se4 (more details), 1.9 Å

PDB Description: staphylococcal enterotoxin b complexed with lactose

SCOP Domain Sequences for d1se4_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se4_1 b.40.2.2 (1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

SCOP Domain Coordinates for d1se4_1:

Click to download the PDB-style file with coordinates for d1se4_1.
(The format of our PDB-style files is described here.)

Timeline for d1se4_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se4_2