Lineage for d4f21c_ (4f21 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871172Species Francisella tularensis [TaxId:177416] [256250] (1 PDB entry)
  8. 1871175Domain d4f21c_: 4f21 C: [251869]
    automated match to d1auoa_
    complexed with 0s1

Details for d4f21c_

PDB Entry: 4f21 (more details), 2.5 Å

PDB Description: crystal structure of carboxylesterase/phospholipase family protein from francisella tularensis
PDB Compounds: (C:) Carboxylesterase/phospholipase family protein

SCOPe Domain Sequences for d4f21c_:

Sequence, based on SEQRES records: (download)

>d4f21c_ c.69.1.0 (C:) automated matches {Francisella tularensis [TaxId: 177416]}
namnyelmepakqarfcviwlhglgadghdfvdivnyfdvsldeirfifphadiipvtin
mgmqmrawydiksldanslnrvvdveginssiakvnklidsqvnqgiaseniilagfsqg
giiatytaitsqrklggimalstylpawdnfkgkitsinkglpilvchgtddqvlpevlg
hdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfiaktfki

Sequence, based on observed residues (ATOM records): (download)

>d4f21c_ c.69.1.0 (C:) automated matches {Francisella tularensis [TaxId: 177416]}
namnyelmepakqarfcviwlhgadghdfvdivnyfdvsldeirfifphadiipvtinmg
mqmrawydiksldslnrvvdveginssiakvnklidsqvnqgiaseniilagfsqggiia
tytaitsqrklggimalstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdls
dklkvsgfaneykhyvgmqhsvcmeeikdisnfiaktfki

SCOPe Domain Coordinates for d4f21c_:

Click to download the PDB-style file with coordinates for d4f21c_.
(The format of our PDB-style files is described here.)

Timeline for d4f21c_: