Lineage for d1d5zc1 (1d5z C:2-121)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1788382Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1788404Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 1788405Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 1788410Domain d1d5zc1: 1d5z C:2-121 [25186]
    Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb1, d1d5zb2, d1d5zc2

Details for d1d5zc1

PDB Entry: 1d5z (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
PDB Compounds: (C:) protein (enterotoxin type b)

SCOPe Domain Sequences for d1d5zc1:

Sequence, based on SEQRES records: (download)

>d1d5zc1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d1d5zc1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskkkrktcmyggvteh

SCOPe Domain Coordinates for d1d5zc1:

Click to download the PDB-style file with coordinates for d1d5zc1.
(The format of our PDB-style files is described here.)

Timeline for d1d5zc1: