Lineage for d3seba1 (3seb A:1-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314261Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1314283Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 1314284Species Staphylococcus aureus [TaxId:1280] [50227] (14 PDB entries)
  8. 1314285Domain d3seba1: 3seb A:1-121 [25184]
    Other proteins in same PDB: d3seba2

Details for d3seba1

PDB Entry: 3seb (more details), 1.48 Å

PDB Description: staphylococcal enterotoxin b
PDB Compounds: (A:) staphylococcal enterotoxin b

SCOPe Domain Sequences for d3seba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3seba1 b.40.2.2 (A:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

SCOPe Domain Coordinates for d3seba1:

Click to download the PDB-style file with coordinates for d3seba1.
(The format of our PDB-style files is described here.)

Timeline for d3seba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3seba2