Lineage for d3seb_1 (3seb 1-121)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110417Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 110429Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 110430Species Staphylococcus aureus [TaxId:1280] [50227] (11 PDB entries)
  8. 110431Domain d3seb_1: 3seb 1-121 [25184]
    Other proteins in same PDB: d3seb_2

Details for d3seb_1

PDB Entry: 3seb (more details), 1.48 Å

PDB Description: staphylococcal enterotoxin b

SCOP Domain Sequences for d3seb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3seb_1 b.40.2.2 (1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

SCOP Domain Coordinates for d3seb_1:

Click to download the PDB-style file with coordinates for d3seb_1.
(The format of our PDB-style files is described here.)

Timeline for d3seb_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3seb_2