Lineage for d3seb_1 (3seb 1-121)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins) Protein Staphylococcal enterotoxin B, SEB [50226] (1 species) Species Staphylococcus aureus [TaxId:1280] [50227] (10 PDB entries) 
Domain d3seb_1: 3seb 1-121 [25184]
Other proteins in same PDB: d3seb_2
Details for d3seb_1
PDB Entry: 3seb (more details), 1.48 Å
PDB Description: staphylococcal enterotoxin b
SCOP Domain Sequences for d3seb_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3seb_1 b.40.2.2 (1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h
SCOP Domain Coordinates for d3seb_1:
Click to download the PDB-style file with coordinates for d3seb_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3seb_1:
- d3seb_1 appears in SCOP 1.57
- d3seb_1 appears in the current release, SCOPe 2.08, called d3seba1
View in 3D
