Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (5 proteins) |
Protein automated matches [226972] (8 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [233275] (8 PDB entries) |
Domain d4ez9d2: 4ez9 D:469-876 [251832] Other proteins in same PDB: d4ez9a1, d4ez9d1 automated match to d3pv8d2 protein/DNA complex; complexed with d3t, mpd, so4 |
PDB Entry: 4ez9 (more details), 1.64 Å
SCOPe Domain Sequences for d4ez9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ez9d2 e.8.1.1 (D:469-876) automated matches {Geobacillus kaustophilus [TaxId: 1462]} eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav nygivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
Timeline for d4ez9d2: