SCOP 1.57: Domain d1ts4b1: 1ts4 B:201-293

Lineage for d1ts4b1 (1ts4 B:201-293)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)

8. Domain d1ts4b1: 1ts4 B:201-293 [25183]
   Other proteins in same PDB: d1ts4a2, d1ts4b2

Details for d1ts4b1

PDB Entry: 1ts4, 3.4 Å

PDB Description: q139k mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1ts4b1:

Sequence; same for both SEQRES and ATOM records:

>d1ts4b1 b.40.2.2 (B:201-293) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

Timeline for d1ts4b1:

• d1ts4b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ts4b1 appears in SCOP 1.59
  
• d1ts4b1 appears in the current release, SCOPe 2.08