Lineage for d4exyb_ (4exy B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1937671Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1937672Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1938079Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1938080Protein automated matches [190418] (15 species)
    not a true protein
  7. 1938106Species Klebsiella pneumoniae [TaxId:573] [189718] (29 PDB entries)
  8. 1938126Domain d4exyb_: 4exy B: [251818]
    automated match to d4ey2a_
    complexed with edo, zn

Details for d4exyb_

PDB Entry: 4exy (more details), 1.47 Å

PDB Description: crystal structure of ndm-1 bound to ethylene glycol
PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4exyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4exyb_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
kakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklrlv

SCOPe Domain Coordinates for d4exyb_:

Click to download the PDB-style file with coordinates for d4exyb_.
(The format of our PDB-style files is described here.)

Timeline for d4exyb_: