SCOPe 2.05: Domain d4exsa_: 4exs A:

Lineage for d4exsa_ (4exs A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (15 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (29 PDB entries)

8. Domain d4exsa_: 4exs A: [251815]
   automated match to d4ey2a_
   complexed with x8z, zn

Details for d4exsa_

PDB Entry: 4exs, 2.4 Å

PDB Description: Crystal structure of NDM-1 bound to L-captopril

PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4exsa_:

Sequence; same for both SEQRES and ATOM records:

>d4exsa_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
kakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklrlv

Timeline for d4exsa_:

• d4exsa_ first appeared in SCOPe 2.04
  
• d4exsa_ is called d4exsa1 in SCOPe 2.06
  
• d4exsa_ appears in the current release, SCOPe 2.08, called d4exsa1