SCOPe 2.06: Domain d4evia1: 4evi A:1-112

Lineage for d4evia1 (4evi A:1-112)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries)

8. Domain d4evia1: 4evi A:1-112 [251811]
   Other proteins in same PDB: d4evia2, d4evib2, d4evib3
   automated match to d4e70a1
   complexed with c9m, gol, n7i, sah

Details for d4evia1

PDB Entry: 4evi, 2.02 Å

PDB Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum in Complex with Coniferyl Alcohol 9-Methyl Ether and S -Adenosyl-L-Homocysteine

PDB Compounds: (A:) Coniferyl alcohol 9-O-methyltransferase

SCOPe Domain Sequences for d4evia1:

Sequence, based on SEQRES records:

>d4evia1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}
mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
qtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp

Sequence, based on observed residues (ATOM records):

>d4evia1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}
mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
qtkapflsrlmrmlvhlgyftqvitklpsywlaplsrlllkqnp

Timeline for d4evia1:

• d4evia1 first appeared in SCOPe 2.04
  
• d4evia1 appears in SCOPe 2.05
  
• d4evia1 appears in SCOPe 2.07
  
• d4evia1 appears in the current release, SCOPe 2.08