Lineage for d4tss_1 (4tss 1-93)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559492Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 559626Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 559627Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)
  8. 559652Domain d4tss_1: 4tss 1-93 [25181]
    Other proteins in same PDB: d4tss_2
    complexed with zn

Details for d4tss_1

PDB Entry: 4tss (more details), 2.75 Å

PDB Description: toxic shock syndrome toxin-1: tetragonal p4(1)2(1)2 crystal form

SCOP Domain Sequences for d4tss_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tss_1 b.40.2.2 (1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOP Domain Coordinates for d4tss_1:

Click to download the PDB-style file with coordinates for d4tss_1.
(The format of our PDB-style files is described here.)

Timeline for d4tss_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tss_2