SCOPe 2.05: Domain d4eusc_: 4eus C:

Lineage for d4eusc_ (4eus C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208963] [255906] (14 PDB entries)

8. Domain d4eusc_: 4eus C: [251809]
   automated match to d4io0a_
   complexed with 0re

Details for d4eusc_

PDB Entry: 4eus, 1.65 Å

PDB Description: crystal structure of the cftr inhibitory factor cif bound to 1,2- hexanediol

PDB Compounds: (C:) Putative hydrolase

SCOPe Domain Sequences for d4eusc_:

Sequence; same for both SEQRES and ATOM records:

>d4eusc_ c.69.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
diarlvymeapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsr

Timeline for d4eusc_:

• d4eusc_ first appeared in SCOPe 2.04
  
• d4eusc_ appears in SCOPe 2.06
  
• d4eusc_ appears in the current release, SCOPe 2.08