Lineage for d1ts5a1 (1ts5 A:1-93)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059243Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)
  7. 2059244Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)
  8. 2059269Domain d1ts5a1: 1ts5 A:1-93 [25179]
    Other proteins in same PDB: d1ts5a2, d1ts5b2
    mutant

Details for d1ts5a1

PDB Entry: 1ts5 (more details), 3.1 Å

PDB Description: i140t mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts5a1 b.40.2.2 (A:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOPe Domain Coordinates for d1ts5a1:

Click to download the PDB-style file with coordinates for d1ts5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ts5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ts5a2