SCOP 1.55: Domain d1ts5a1: 1ts5 A:1-93

Lineage for d1ts5a1 (1ts5 A:1-93)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)

8. Domain d1ts5a1: 1ts5 A:1-93 [25179]
   Other proteins in same PDB: d1ts5a2, d1ts5b2

Details for d1ts5a1

PDB Entry: 1ts5, 3.1 Å

PDB Description: i140t mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1ts5a1:

Sequence; same for both SEQRES and ATOM records:

>d1ts5a1 b.40.2.2 (A:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

Timeline for d1ts5a1:

• d1ts5a1 appears in SCOP 1.57
  
• d1ts5a1 appears in the current release, SCOPe 2.08