Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (64 species) not a true protein |
Species Linum nodiflorum [TaxId:407264] [234382] (3 PDB entries) |
Domain d4emsa2: 4ems A:113-368 [251776] Other proteins in same PDB: d4emsa1, d4emsb1, d4emsb3 automated match to d4e70a2 complexed with gol |
PDB Entry: 4ems (more details), 1.75 Å
SCOPe Domain Sequences for d4emsa2:
Sequence, based on SEQRES records: (download)
>d4emsa2 c.66.1.0 (A:113-368) automated matches {Linum nodiflorum [TaxId: 407264]} ynarsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafahegkkvyevcsedanfs qlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviaetfpnihctvfdl phvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlkmlkqckkaltkn gvkgklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqwaklfaeagfkdy kitpvgglrvlievyp
>d4emsa2 c.66.1.0 (A:113-368) automated matches {Linum nodiflorum [TaxId: 407264]} ynarsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafahegkkvyevcsedanfs qlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviaetfpnihctvfdl phvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlkmlkqckkaltkk gklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqwaklfaeagfkdykit pvgglrvlievyp
Timeline for d4emsa2: