SCOPe 2.06: Domain d4emsa1: 4ems A:1-112

Lineage for d4emsa1 (4ems A:1-112)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries)

8. Domain d4emsa1: 4ems A:1-112 [251775]
   Other proteins in same PDB: d4emsa2, d4emsb2, d4emsb3
   automated match to d4e70a1
   complexed with gol

Details for d4emsa1

PDB Entry: 4ems, 1.75 Å

PDB Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum

PDB Compounds: (A:) Coniferyl alcohol 9-O-methyltransferase

SCOPe Domain Sequences for d4emsa1:

Sequence, based on SEQRES records:

>d4emsa1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}
mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
qtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp

Sequence, based on observed residues (ATOM records):

>d4emsa1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}
mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
qtkapflsrlmrmlvhlgyftqvitkplpsywlaplsrlllkqnp

Timeline for d4emsa1:

• d4emsa1 first appeared in SCOPe 2.04
  
• d4emsa1 appears in SCOPe 2.05
  
• d4emsa1 appears in SCOPe 2.07
  
• d4emsa1 appears in the current release, SCOPe 2.08