Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d4ei5h2: 4ei5 H:116-237 [251769] Other proteins in same PDB: d4ei5b_, d4ei5c2, d4ei5e1, d4ei5e3, d4ei5f_ automated match to d3q5ya2 complexed with cis, flc, nag |
PDB Entry: 4ei5 (more details), 3.1 Å
SCOPe Domain Sequences for d4ei5h2:
Sequence, based on SEQRES records: (download)
>d4ei5h2 b.1.1.0 (H:116-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv sa
>d4ei5h2 b.1.1.0 (H:116-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq pndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa
Timeline for d4ei5h2: