SCOPe 2.05: Domain d4ei5e1: 4ei5 E:7-185

Lineage for d4ei5e1 (4ei5 E:7-185)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)

8. Domain d4ei5e1: 4ei5 E:7-185 [251764]
   Other proteins in same PDB: d4ei5b_, d4ei5c1, d4ei5c2, d4ei5d1, d4ei5d2, d4ei5e2, d4ei5f_, d4ei5g1, d4ei5h1, d4ei5h2
   automated match to d4f7ca1
   complexed with cis, flc, nag

Details for d4ei5e1

PDB Entry: 4ei5, 3.1 Å

PDB Description: crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1

PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4ei5e1:

Sequence; same for both SEQRES and ATOM records:

>d4ei5e1 d.19.1.1 (E:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d4ei5e1:

• d4ei5e1 first appeared in SCOPe 2.04
  
• d4ei5e1 appears in SCOPe 2.06
  
• d4ei5e1 appears in the current release, SCOPe 2.08