Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d4ei5c2: 4ei5 C:115-202 [251761] Other proteins in same PDB: d4ei5b_, d4ei5c1, d4ei5d1, d4ei5d2, d4ei5e1, d4ei5e2, d4ei5e3, d4ei5f_, d4ei5g1, d4ei5h1, d4ei5h2 automated match to d2pyfa2 complexed with cis, flc, nag |
PDB Entry: 4ei5 (more details), 3.1 Å
SCOPe Domain Sequences for d4ei5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ei5c2 b.1.1.2 (C:115-202) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
Timeline for d4ei5c2: