Lineage for d1ts2c1 (1ts2 C:401-493)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 799193Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
  6. 799342Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 799343Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)
  8. 799360Domain d1ts2c1: 1ts2 C:401-493 [25176]
    Other proteins in same PDB: d1ts2a2, d1ts2b2, d1ts2c2
    mutant

Details for d1ts2c1

PDB Entry: 1ts2 (more details), 2.3 Å

PDB Description: t128a mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (C:) toxic shock syndrome toxin-1

SCOP Domain Sequences for d1ts2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts2c1 b.40.2.2 (C:401-493) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOP Domain Coordinates for d1ts2c1:

Click to download the PDB-style file with coordinates for d1ts2c1.
(The format of our PDB-style files is described here.)

Timeline for d1ts2c1: