Lineage for d4ef9a1 (4ef9 A:1-312)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828301Protein automated matches [190228] (20 species)
    not a true protein
  7. 2828355Species Leishmania major [TaxId:5664] [255853] (9 PDB entries)
  8. 2828358Domain d4ef9a1: 4ef9 A:1-312 [251741]
    Other proteins in same PDB: d4ef9a2, d4ef9b2
    automated match to d3c61a_
    complexed with 4nf, fmn, gol, so4

Details for d4ef9a1

PDB Entry: 4ef9 (more details), 1.6 Å

PDB Description: Crystal structure of dihydroorotate dehydrogenase from Leishmania major in complex with 4-Nitrophenyl isothiocyanate
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d4ef9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ef9a1 c.1.4.1 (A:1-312) automated matches {Leishmania major [TaxId: 5664]}
mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq
alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate
kgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaae
ilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrr
cpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryq
tldefrgkvrtl

SCOPe Domain Coordinates for d4ef9a1:

Click to download the PDB-style file with coordinates for d4ef9a1.
(The format of our PDB-style files is described here.)

Timeline for d4ef9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ef9a2