SCOPe 2.05: Domain d1ts2a1: 1ts2 A:1-93

Lineage for d1ts2a1 (1ts2 A:1-93)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)

8. Domain d1ts2a1: 1ts2 A:1-93 [25174]
   Other proteins in same PDB: d1ts2a2, d1ts2b2, d1ts2c2
   mutant

Details for d1ts2a1

PDB Entry: 1ts2, 2.3 Å

PDB Description: t128a mutant of toxic shock syndrome toxin-1 from s. aureus

PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ts2a1 b.40.2.2 (A:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

Timeline for d1ts2a1:

• d1ts2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ts2a1 appears in SCOPe 2.04
  
• d1ts2a1 appears in SCOPe 2.06
  
• d1ts2a1 appears in the current release, SCOPe 2.08