SCOPe 2.08: Domain d4edpb_: 4edp B:

Lineage for d4edpb_ (4edp B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:195103] [256247] (1 PDB entry)

8. Domain d4edpb_: 4edp B: [251732]
   automated match to d3ttnb_
   complexed with act, cl

Details for d4edpb_

PDB Entry: 4edp, 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of an abc transporter from clostridium perfringens atcc 13124

PDB Compounds: (B:) ABC transporter, substrate-binding protein

SCOPe Domain Sequences for d4edpb_:

Sequence; same for both SEQRES and ATOM records:

>d4edpb_ c.94.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 195103]}
klvvstwglnedvlketvfepfakehgveivldignnserltkmknnpnsqiditylaes
faeqgveagifdkldyskipnasemnekakstveagygpaytlnsigivvdpsagieins
wedlwkpelknkiaipditttngpamveiaaekagvdvktdngeaafkelealkpnvvkt
yskssdlanmfsngeivaavasdfafgtiskakpevinvipesgtylnfntininknskn
kdlayefinyalskevqektakalnespvnkevklseeetknltygpvvdnakvidfkfv
nsvmdqwvnnwnrimn

Timeline for d4edpb_:

• d4edpb_ first appeared in SCOPe 2.04
  
• d4edpb_ appears in SCOPe 2.07