Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Clostridium perfringens [TaxId:195103] [256247] (1 PDB entry) |
Domain d4edpb_: 4edp B: [251732] automated match to d3ttnb_ complexed with act, cl |
PDB Entry: 4edp (more details), 1.85 Å
SCOPe Domain Sequences for d4edpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4edpb_ c.94.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 195103]} klvvstwglnedvlketvfepfakehgveivldignnserltkmknnpnsqiditylaes faeqgveagifdkldyskipnasemnekakstveagygpaytlnsigivvdpsagieins wedlwkpelknkiaipditttngpamveiaaekagvdvktdngeaafkelealkpnvvkt yskssdlanmfsngeivaavasdfafgtiskakpevinvipesgtylnfntininknskn kdlayefinyalskevqektakalnespvnkevklseeetknltygpvvdnakvidfkfv nsvmdqwvnnwnrimn
Timeline for d4edpb_: