Lineage for d1qilc1 (1qil C:1-93)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787828Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1788382Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1788557Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)
  7. 1788558Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)
  8. 1788575Domain d1qilc1: 1qil C:1-93 [25173]
    Other proteins in same PDB: d1qila2, d1qilb2, d1qilc2
    mutant

Details for d1qilc1

PDB Entry: 1qil (more details), 2.5 Å

PDB Description: inactive mutant toxic shock syndrome toxin-1 at 2.5 a
PDB Compounds: (C:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1qilc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qilc1 b.40.2.2 (C:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOPe Domain Coordinates for d1qilc1:

Click to download the PDB-style file with coordinates for d1qilc1.
(The format of our PDB-style files is described here.)

Timeline for d1qilc1: