Lineage for d4edha_ (4edh A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598453Species Pseudomonas aeruginosa [TaxId:208964] [226294] (7 PDB entries)
  8. 1598454Domain d4edha_: 4edh A: [251729]
    automated match to d3uwob_
    complexed with adp, edo, mg, so4, tmp, trs

Details for d4edha_

PDB Entry: 4edh (more details), 1.32 Å

PDB Description: The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with ADP,TMP and Mg.
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4edha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4edha_ c.37.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
fvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqapery
qvldaglplaevqagldrllpnllerln

SCOPe Domain Coordinates for d4edha_:

Click to download the PDB-style file with coordinates for d4edha_.
(The format of our PDB-style files is described here.)

Timeline for d4edha_: