Lineage for d1qilb1 (1qil B:1-93)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398572Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2398747Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)
  7. 2398748Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)
  8. 2398764Domain d1qilb1: 1qil B:1-93 [25172]
    Other proteins in same PDB: d1qila2, d1qilb2, d1qilc2
    mutant

Details for d1qilb1

PDB Entry: 1qil (more details), 2.5 Å

PDB Description: inactive mutant toxic shock syndrome toxin-1 at 2.5 a
PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1qilb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qilb1 b.40.2.2 (B:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOPe Domain Coordinates for d1qilb1:

Click to download the PDB-style file with coordinates for d1qilb1.
(The format of our PDB-style files is described here.)

Timeline for d1qilb1: