Lineage for d4e5ub_ (4e5u B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129056Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (11 PDB entries)
  8. 2129062Domain d4e5ub_: 4e5u B: [251694]
    automated match to d3uwob_
    complexed with ca, tmp

Details for d4e5ub_

PDB Entry: 4e5u (more details), 1.81 Å

PDB Description: The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with thymidine monophosphate.
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4e5ub_:

Sequence, based on SEQRES records: (download)

>d4e5ub_ c.37.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
fvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqapery
qvldaglplaevqagldrllpnllerln

Sequence, based on observed residues (ATOM records): (download)

>d4e5ub_ c.37.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tglfvtlegpegastnrdylaerlrergievqltrepggtplaerirelllapsdepmaa
dtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesfv
qgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqaperyqv
ldaglplaevqagldrllpnllerln

SCOPe Domain Coordinates for d4e5ub_:

Click to download the PDB-style file with coordinates for d4e5ub_.
(The format of our PDB-style files is described here.)

Timeline for d4e5ub_: