Lineage for d1ts3b1 (1ts3 B:201-293)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123908Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 1124414Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)
  6. 1124563Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 1124564Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)
  8. 1124577Domain d1ts3b1: 1ts3 B:201-293 [25169]
    Other proteins in same PDB: d1ts3a2, d1ts3b2, d1ts3c2
    mutant

Details for d1ts3b1

PDB Entry: 1ts3 (more details), 2 Å

PDB Description: h135a mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts3b1 b.40.2.2 (B:201-293) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOPe Domain Coordinates for d1ts3b1:

Click to download the PDB-style file with coordinates for d1ts3b1.
(The format of our PDB-style files is described here.)

Timeline for d1ts3b1: