Lineage for d1aw7b1 (1aw7 B:201-293)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540834Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1541003Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)
  7. 1541004Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)
  8. 1541010Domain d1aw7b1: 1aw7 B:201-293 [25165]
    Other proteins in same PDB: d1aw7a2, d1aw7b2, d1aw7c2, d1aw7d2
    mutant

Details for d1aw7b1

PDB Entry: 1aw7 (more details), 1.95 Å

PDB Description: q136a mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1aw7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw7b1 b.40.2.2 (B:201-293) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOPe Domain Coordinates for d1aw7b1:

Click to download the PDB-style file with coordinates for d1aw7b1.
(The format of our PDB-style files is described here.)

Timeline for d1aw7b1: