Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [196823] (68 PDB entries) |
Domain d4dzwa_: 4dzw A: [251635] automated match to d1yhla_ complexed with 0mq, ipe, mg, so4 |
PDB Entry: 4dzw (more details), 3.05 Å
SCOPe Domain Sequences for d4dzwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dzwa_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
Timeline for d4dzwa_: