SCOPe 2.05: Domain d4dyea2: 4dye A:121-375

Lineage for d4dyea2 (4dye A:121-375)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [256242] (1 PDB entry)

8. Domain d4dyea2: 4dye A:121-375 [251629]
   Other proteins in same PDB: d4dyea1
   automated match to d2oqha2
   complexed with edo, gol

Details for d4dyea2

PDB Entry: 4dye, 1.6 Å

PDB Description: crystal structure of an enolase (putative sugar isomerase, target efi- 502095) from streptomyces coelicolor, no mg, ordered loop

PDB Compounds: (A:) isomerase

SCOPe Domain Sequences for d4dyea2:

Sequence; same for both SEQRES and ATOM records:

>d4dyea2 c.1.11.0 (A:121-375) automated matches {Streptomyces coelicolor [TaxId: 1902]}
avrdevpitalitradapgatpadlpkamaehavrvveeggfdavklkgttdcagdvail
ravrealpgvnlrvdpnaawsvpdsvragialeeldleyledpcvgiegmaqvkakvrip
lctnmcvvrfedfapamrlnavdvihgdvykwggiaatkalaahcetfglgmnlhsggel
giataahlavvsstpvlsraidsmyylhaddiieplhlengrlrvpsgpglgvsvdedkl
rhyagvnerdgdltg

Timeline for d4dyea2:

• d4dyea2 first appeared in SCOPe 2.04
  
• d4dyea2 appears in SCOPe 2.06
  
• d4dyea2 appears in the current release, SCOPe 2.08