Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (24 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
Domain d4duxd1: 4dux D:9-219 [251621] Other proteins in same PDB: d4duxa2, d4duxa3, d4duxa4, d4duxa5, d4duxb2, d4duxb3, d4duxb4, d4duxb5, d4duxc2, d4duxc3, d4duxc4, d4duxc5, d4duxd2, d4duxd3, d4duxd4, d4duxd5 automated match to d1f49a3 complexed with 0mk, dms, mg, na |
PDB Entry: 4dux (more details), 2.3 Å
SCOPe Domain Sequences for d4duxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duxd1 b.18.1.0 (D:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d4duxd1:
View in 3D Domains from same chain: (mouse over for more information) d4duxd2, d4duxd3, d4duxd4, d4duxd5 |