![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
![]() | Domain d4duxc5: 4dux C:731-1023 [251620] Other proteins in same PDB: d4duxa1, d4duxa2, d4duxa3, d4duxa4, d4duxb1, d4duxb2, d4duxb3, d4duxb4, d4duxc1, d4duxc2, d4duxc3, d4duxc4, d4duxd1, d4duxd2, d4duxd3, d4duxd4 automated match to d1jz8a4 complexed with 0mk, dms, mg, na |
PDB Entry: 4dux (more details), 2.3 Å
SCOPe Domain Sequences for d4duxc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duxc5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d4duxc5:
![]() Domains from same chain: (mouse over for more information) d4duxc1, d4duxc2, d4duxc3, d4duxc4 |