Lineage for d2tssb1 (2tss B:1-93)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 463253Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 463387Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 463388Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)
  8. 463391Domain d2tssb1: 2tss B:1-93 [25162]
    Other proteins in same PDB: d2tssa2, d2tssb2, d2tssc2

Details for d2tssb1

PDB Entry: 2tss (more details), 2.05 Å

PDB Description: toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form

SCOP Domain Sequences for d2tssb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tssb1 b.40.2.2 (B:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOP Domain Coordinates for d2tssb1:

Click to download the PDB-style file with coordinates for d2tssb1.
(The format of our PDB-style files is described here.)

Timeline for d2tssb1: