Lineage for d2tssb1 (2tss B:1-93)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110417Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 110505Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 110506Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)
  8. 110509Domain d2tssb1: 2tss B:1-93 [25162]
    Other proteins in same PDB: d2tssa2, d2tssb2, d2tssc2

Details for d2tssb1

PDB Entry: 2tss (more details), 2.05 Å

PDB Description: toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form

SCOP Domain Sequences for d2tssb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tssb1 b.40.2.2 (B:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOP Domain Coordinates for d2tssb1:

Click to download the PDB-style file with coordinates for d2tssb1.
(The format of our PDB-style files is described here.)

Timeline for d2tssb1: