SCOPe 2.05: Domain d4duxb3: 4dux B:334-625

Lineage for d4duxb3 (4dux B:334-625)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)

8. Domain d4duxb3: 4dux B:334-625 [251613]
   Other proteins in same PDB: d4duxa1, d4duxa2, d4duxa4, d4duxa5, d4duxb1, d4duxb2, d4duxb4, d4duxb5, d4duxc1, d4duxc2, d4duxc4, d4duxc5, d4duxd1, d4duxd2, d4duxd4, d4duxd5
   automated match to d1jz7a5
   complexed with 0mk, dms, mg, na

Details for d4duxb3

PDB Entry: 4dux, 2.3 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460s) in complex with l-ribose

PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d4duxb3:

Sequence; same for both SEQRES and ATOM records:

>d4duxb3 c.1.8.0 (B:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgsesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

Timeline for d4duxb3:

• d4duxb3 first appeared in SCOPe 2.04
  
• d4duxb3 appears in SCOPe 2.06
  
• d4duxb3 appears in the current release, SCOPe 2.08