Lineage for d3tss_1 (3tss 5-93)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13929Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 14009Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 14010Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)
  8. 14011Domain d3tss_1: 3tss 5-93 [25160]
    Other proteins in same PDB: d3tss_2

Details for d3tss_1

PDB Entry: 3tss (more details), 1.9 Å

PDB Description: toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
PDB Compounds: ( :)

SCOP Domain Sequences for d3tss_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tss_1 b.40.2.2 (5-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
nikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgekvdl
ntkrikksqhtsegtwihfqisgvtntek

SCOP Domain Coordinates for d3tss_1:

Click to download the PDB-style file with coordinates for d3tss_1.
(The format of our PDB-style files is described here.)

Timeline for d3tss_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tss_2