Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d4duwc4: 4duw C:626-730 [251599] Other proteins in same PDB: d4duwa1, d4duwa3, d4duwa5, d4duwb1, d4duwb3, d4duwb5, d4duwc1, d4duwc3, d4duwc5, d4duwd1, d4duwd3, d4duwd5 automated match to d1jz8a2 complexed with dms, lak, mg, na |
PDB Entry: 4duw (more details), 2.2 Å
SCOPe Domain Sequences for d4duwc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duwc4 b.1.4.0 (C:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d4duwc4:
View in 3D Domains from same chain: (mouse over for more information) d4duwc1, d4duwc2, d4duwc3, d4duwc5 |